PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020753m
Common NameCARUB_v10020753mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 284aa    MW: 31698.7 Da    PI: 5.6745
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020753mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.8e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +lv +++++G g W + +++ g+ R++k+c++rw++yl
  Carubv10020753m 14 KGEWTGEEDRKLVAYINEHGLGEWGSMPKRAGLQRCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding56.66.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eE++ +++ +++lG++ W++Ia+ ++ +Rt++++k++w++ 
  Carubv10020753m  67 RGKFTPEEEDEIIKHHALLGNR-WAAIAKQLP-NRTDNDIKNHWNSC 111
                      89********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.004961IPR017930Myb domain
SuperFamilySSF466899.16E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-221568IPR009057Homeodomain-like
CDDcd001671.38E-91661No hitNo description
PROSITE profilePS5129427.27462116IPR017930Myb domain
SMARTSM007178.9E-1766114IPR001005SANT/Myb domain
PfamPF002497.3E-1767111IPR001005SANT/Myb domain
CDDcd001673.62E-1169109No hitNo description
Gene3DG3DSA:1.10.10.609.2E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGRTTWFDVD GMRKGEWTGE EDRKLVAYIN EHGLGEWGSM PKRAGLQRCG KSCRLRWLNY  60
LRPGIKRGKF TPEEEDEIIK HHALLGNRWA AIAKQLPNRT DNDIKNHWNS CLKKRLAKSG  120
IDPMTHEPKS LTIDVVSSSS STTSSPIPSP CSSSFSSSSS SAGSARLLNK LAAGISSRKH  180
GLERIKTVIL SEQPRDQAEA EEEKKMLISM EHDEMIACLM DIDEKMNIAS FDEVPFDGYS  240
TATATTTSGF MAFDDFYSPV NPDTTLYESD FYDETEQLGL FLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2172050.0AF217205.2 Arabidopsis thaliana putative transcription factor (MYB95) mRNA, complete cds.
GenBankAK1183810.0AK118381.1 Arabidopsis thaliana At1g74430 mRNA for putative transcription factor (MYB95), complete cds, clone: RAFL19-64-J20.
GenBankAY5195700.0AY519570.1 Arabidopsis thaliana MYB transcription factor (At1g74430) mRNA, complete cds.
GenBankBT0052720.0BT005272.1 Arabidopsis thaliana At1g74430 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302649.10.0hypothetical protein CARUB_v10020753mg
SwissprotO643991e-59MYB34_ARATH; Transcription factor MYB34
TrEMBLR0GI520.0R0GI52_9BRAS; Uncharacterized protein
STRINGAT1G74430.11e-132(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74430.11e-131myb domain protein 95